Structure of PDB 4u4y Chain e0

Receptor sequence
>4u4ye0 (length=62) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AKVHGSLARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVN
GKRRMNPGPSVQ
3D structure
PDB4u4y ?
Chaine0
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna e0 A2 R10 A11 G12 K13 V14 K15 Q17 T18 V21 K26 K28 K31 R33 A34 R37 R42 R43 R55 M56 N57 G59 A1 R9 A10 G11 K12 V13 K14 Q16 T17 V20 K25 K27 K30 R32 A33 R36 R41 R42 R54 M55 N56 G58
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0010494 cytoplasmic stress granule
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4u4y, PDBe:4u4y, PDBj:4u4y
PDBsum4u4y
PubMed25209664
UniProtP0CX33|RS30A_YEAST Small ribosomal subunit protein eS30A (Gene Name=RPS30A)

[Back to BioLiP]