Structure of PDB 9c4g Chain e

Receptor sequence

>9c4ge (length=210) Species: 1747 (Cutibacterium acnes) [Search protein sequence]

ETKTIDVLDVKGKKAGSAELPGDLFDVNTNIPLIHQVVVAQLAAARQGTH
ATKTRGQVSGGGKKPWRQKGTGRARQGSTRAPQWVGGGTVHGPQPRSYAQ
RTPKKMVGAALRGALSDMARDNRIFVVTSLVDGDKPSTKQAKAVLSGLAE
LRKVLVVLDRSDEIDWLSVRNLSEVHVLAADQLNTYDVVNARTIVFSQAG
LDAFVGARSA

3D structure

PDB

9c4g Mechanistic basis for the translation inhibition of Cutibacterium acnes by Clindamycin.

Chain

Resolution

2.53 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	N32 H37 Q38 Q43 L44 A47 R48 Q49 T51 H52 A53 K55 T56 R57 G58 V60 S61 G62 K65 K66 R69 Q70 K71 G72 G74 R75 A76 R77 Q78 G79 R82 P84 Q85 W86 V87 G88 T91 V92 H93 P95 R98 Q102 R103 P105 K106 K107 M108 K137 P138 S139 L153 D161 W168 L169 R172 N173 H178 Q184 N186 Y188 D189 N192 R194	N30 H35 Q36 Q41 L42 A45 R46 Q47 T49 H50 A51 K53 T54 R55 G56 V58 S59 G60 K63 K64 R67 Q68 K69 G70 G72 R73 A74 R75 Q76 G77 R80 P82 Q83 W84 V85 G86 T89 V90 H91 P93 R96 Q100 R101 P103 K104 K105 M106 K135 P136 S137 L151 D159 W166 L167 R170 N171 H176 Q182 N184 Y186 D187 N190 R192

External links

PDB	RCSB:9c4g, PDBe:9c4g, PDBj:9c4g
PDBsum	9c4g
PubMed	39122144
UniProt	A0A2B7I5M5

[Back to BioLiP]