Structure of PDB 8xlp Chain e |
>8xlpe (length=64) Species: 52970 (Rhodomonas salina) [Search protein sequence] |
YWIIHSITIPALFVAGWLFVSTGLAYDIFGTPRPNEYFTQERQQVPLVND RFSAKQELEDLTKG |
|
PDB | 8xlp Structure of inactive Photosystem II associated with CAC antenna from Rhodomonas Salina |
Chain | e |
Resolution | 2.57 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
HEM |
e |
Y20 I23 H24 T27 I28 |
Y1 I4 H5 T8 I9 |
|
|
|
|