Structure of PDB 8wif Chain e

Receptor sequence

>8wife (length=200) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

ARYTGPATRKSRRLGVDLVGGDQSFEKRPYPPGQHGRARIKESEYRQQLQ
EKQKARFSYGVMEKQFRRYYEEANRQPGKTGDNLLRILESRLDNVVYRAG
LARTRRMARQLVSHGHFLVNGVKVDIPSYRVSQYDIIDVKEKSLNTLPFQ
IARETAGERPIPSWLQVVGERQRILVHQLPERAQIDVPLTEQLIVELYSK

3D structure

• PDB: 8wif Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
• Chain: e
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	A2 R3 P7 T9 R10 R13 R14 R29 P33 G34 Q35 H36 K42 Y46 K53 Q54 M63 E64 K65 Q66 N75 R76 R104 T105 R107 M108 R110 Q111 S114 H115 H117 V125 D126 I127 S129 Y130 P149 E197 S200 K201	A1 R2 P6 T8 R9 R12 R13 R28 P32 G33 Q34 H35 K41 Y45 K52 Q53 M62 E63 K64 Q65 N74 R75 R103 T104 R106 M107 R109 Q110 S113 H114 H116 V124 D125 I126 S128 Y129 P148 E196 S199 K200

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8wif, PDBe:8wif, PDBj:8wif
• PDBsum: 8wif
• PubMed: 38245551
• UniProt: A0QSL7|RS4_MYCS2 Small ribosomal subunit protein uS4 (Gene Name=rpsD)