Structure of PDB 8wib Chain e

Receptor sequence
>8wibe (length=200) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
ARYTGPATRKSRRLGVDLVGGDQSFEKRPYPPGQHGRARIKESEYRQQLQ
EKQKARFSYGVMEKQFRRYYEEANRQPGKTGDNLLRILESRLDNVVYRAG
LARTRRMARQLVSHGHFLVNGVKVDIPSYRVSQYDIIDVKEKSLNTLPFQ
IARETAGERPIPSWLQVVGERQRILVHQLPERAQIDVPLTEQLIVELYSK
3D structure
PDB8wib Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Chaine
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e A2 R3 P7 T9 R10 R29 H36 K42 Q54 M63 E64 K65 Q66 N75 R76 R104 R110 Q111 S114 H115 H117 D126 I127 S129 Y130 E197 S200 K201 A1 R2 P6 T8 R9 R28 H35 K41 Q53 M62 E63 K64 Q65 N74 R75 R103 R109 Q110 S113 H114 H116 D125 I126 S128 Y129 E196 S199 K200
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wib, PDBe:8wib, PDBj:8wib
PDBsum8wib
PubMed38245551
UniProtA0QSL7|RS4_MYCS2 Small ribosomal subunit protein uS4 (Gene Name=rpsD)

[Back to BioLiP]