Structure of PDB 8v87 Chain e

Receptor sequence

>8v87e (length=125) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

LPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRRRFRGNISQP
KIGYGSNKKTKFLSPSGHKTFLVANVKDLETLTMHTKTYAAEIAHNISAK
NRVVILARAKALGIKVTNPKGRLAL

3D structure

PDB

8v87 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.

Chain

Resolution

2.66 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	P5 H6 K11 K12 K16 F17 R19 D23 R24 Y25 H26 R27 V28 W32 R33 K34 R43 R44 R45 F46 R47 P53 K54 I55 G56 Y57 G58 S59 N60 K61 K62 F65 L75 N78 K80 E95 A97 H98 N99 I100 S101 N104 R105 N121 K123 R125	P2 H3 K8 K9 K13 F14 R16 D20 R21 Y22 H23 R24 V25 W29 R30 K31 R40 R41 R42 F43 R44 P50 K51 I52 G53 Y54 G55 S56 N57 K58 K59 F62 L72 N75 K77 E92 A94 H95 N96 I97 S98 N101 R102 N118 K120 R122

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8v87, PDBe:8v87, PDBj:8v87
PDBsum	8v87
PubMed	38632236
UniProt	P38061\|RL32_YEAST Large ribosomal subunit protein eL32 (Gene Name=RPL32)