Structure of PDB 8s8g Chain e

Receptor sequence
>8s8ge (length=60) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]
GKVHGSLARAGKVKSQTPKVEKQEKPKQPKGRAYKRLLYTRRFVNVTLTN
GKRKMNPSPS
3D structure
PDB8s8g Structural basis of AUC codon discrimination during translation initiation in yeast.
Chaine
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e H5 L8 A9 A11 V14 K15 Q17 T18 V21 E22 K23 Q24 K26 K28 P30 K31 R33 A34 R37 L39 R43 N46 M56 N57 S59 H4 L7 A8 A10 V13 K14 Q16 T17 V20 E21 K22 Q23 K25 K27 P29 K30 R32 A33 R36 L38 R42 N45 M55 N56 S58
External links