Structure of PDB 8ro0 Chain e |
>8ro0e (length=80) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] |
VQPVNLIFRYLQNRTRVQIWLYEDVTHRLEGYIIGFDEFMNVVFDEAEEV NMKTKGRNKIGRILLKGDNITLIHAAQQEA |
|
PDB | 8ro0 Mechanism for the initiation of spliceosome disassembly. |
Chain | e |
Resolution | 2.9 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
e |
Y32 E33 F49 K63 |
Y22 E23 F39 K53 |
|
|
|