Structure of PDB 8p2f Chain e

Receptor sequence

>8p2fe (length=199) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

ARFRGSNWKKSRRLGISLSGTGKELEKRPYAPGQHGPNQRKKLSEYGLQL
REKQKLRYLYGMTERQFRNTFDIAGKKFGVHGENFMILLASRLDAVVYSL
GLARTRRQARQLVNHGHILVDGKRVDIPSYSVKPGQTISVREKSQKLNII
VESVEINNFVPEYLNFDADSLTGTFVRLPERSELPAEINEQLIVEYYSR

3D structure

PDB

8p2f Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid

Chain

Resolution

2.44 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	A2 R3 R5 S7 W9 K10 R13 R14 K28 R29 Y31 G34 Q35 H36 Y47 L51 K54 Q55 T64 E65 R66 Q67 K77 R105 T106 R108 Q109 R111 Q112 N115 H116 H118 D127 I128 S130 L148 E196 R200	A1 R2 R4 S6 W8 K9 R12 R13 K27 R28 Y30 G33 Q34 H35 Y46 L50 K53 Q54 T63 E64 R65 Q66 K76 R104 T105 R107 Q108 R110 Q111 N114 H115 H117 D126 I127 S129 L147 E195 R199

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8p2f, PDBe:8p2f, PDBj:8p2f
PDBsum	8p2f
PubMed	38902339
UniProt	Q2FXK6\|RS4_STAA8 Small ribosomal subunit protein uS4 (Gene Name=rpsD)

[Back to BioLiP]