Structure of PDB 8jho Chain e

Receptor sequence
>8jhoe (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB8jho Structure of histone deacetylase complex Rpd3S bound to nucleosome
Chaine
Resolution7.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna e R40 Y41 P43 G44 V46 A47 K64 L65 P66 R69 R4 Y5 P7 G8 V10 A11 K28 L29 P30 R33
BS02 dna e H39 R40 Y41 R42 T45 R72 R83 F84 R116 V117 T118 H3 R4 Y5 R6 T9 R36 R47 F48 R80 V81 T82
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8jho, PDBe:8jho, PDBj:8jho
PDBsum8jho
PubMed37798513
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]