Structure of PDB 8fn2 Chain e

Receptor sequence
>8fn2e (length=51) Species: 224326 (Borreliella burgdorferi B31) [Search protein sequence]
AVELISLICEETGIRNYTTTKNRRNKQEKLELMKYCPKLRKHTLHKEGKI
K
3D structure
PDB8fn2 The structure of a hibernating ribosome in a Lyme disease pathogen.
Chaine
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e V10 Y25 T26 N30 K34 L38 L40 M41 K42 Y43 R48 K49 H50 I58 K59 V2 Y17 T18 N22 K26 L30 L32 M33 K34 Y35 R40 K41 H42 I50 K51
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fn2, PDBe:8fn2, PDBj:8fn2
PDBsum8fn2
PubMed37907464
UniProtO51357|RL33_BORBU Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]