Structure of PDB 8ccs Chain e

Receptor sequence

>8ccse (length=212) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

VVDPFTRKEWFDIKAPSTFENRNVGKTLVNKSTGLKSASDALKGRVVEVC
LADLQGSEDHSFRKIKLRVDEVQGKNLLTNFHGMDFTTDKLRSMVRKWQT
LIEANVTVKTSDDYVLRIFAIAFTRKQANQVKRHSYAQSSHIRAIRKVIS
EILTKEVQGSTLAQLTSKLIPEVINKEIENATKDIFPLQNIHVRKVKLLK
QPKFDVGALMAL

3D structure

PDB

8ccs Cryo-EM analysis of eukaryotic ribosome translocation intermediates

Chain

Resolution

1.97 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	P23 K27 V65 H101 R111 V114 K116 W117 Q118 R136 F138 Q146 N148 Q149 V150 K151 R152 H153 Y155 Q157 S159 H160 R165 K202 D203 I204 F205 K214 K216	P4 K8 V46 H82 R92 V95 K97 W98 Q99 R117 F119 Q127 N129 Q130 V131 K132 R133 H134 Y136 Q138 S140 H141 R146 K183 D184 I185 F186 K195 K197

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ccs, PDBe:8ccs, PDBj:8ccs
PDBsum	8ccs
PubMed	38030725
UniProt	P33442\|RS3A1_YEAST Small ribosomal subunit protein eS1A (Gene Name=RPS1A)

[Back to BioLiP]