Structure of PDB 8bvw Chain e

Receptor sequence
>8bvwe (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB8bvw Structural basis of transcription reduction by a promoter-proximal +1 nucleosome.
Chaine
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna e R41 Y42 G45 V47 R64 K65 L66 P67 R70 R84 R4 Y5 G8 V10 R27 K28 L29 P30 R33 R47
BS02 dna e R43 P44 R64 R73 R84 F85 S87 R117 V118 T119 M121 R6 P7 R27 R36 R47 F48 S50 R80 V81 T82 M84
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8bvw, PDBe:8bvw, PDBj:8bvw
PDBsum8bvw
PubMed37148879
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]