Structure of PDB 8bh6 Chain e

Receptor sequence
>8bh6e (length=164) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
RREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGK
AQEVPEAIKKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPG
TGVIAGGPVRAVLELAGITDILSKSLGSNTPINMVRATIDGLQNLKNAED
VAKLRGKTVEELYN
3D structure
PDB8bh6 Ribosome maturation factor P (RimP) from Staphylococcus aureus
Chaine
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e V21 K23 V24 V25 K26 G27 R32 K52 K62 K69 R88 Y89 S91 F95 K97 A99 T103 I106 A107 G108 L124 K126 S127 S130 T132 I134 N135 V19 K21 V22 V23 K24 G25 R30 K50 K60 K67 R86 Y87 S89 F93 K95 A97 T101 I104 A105 G106 L122 K124 S125 S128 T130 I132 N133
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bh6, PDBe:8bh6, PDBj:8bh6
PDBsum8bh6
PubMed
UniProtQ2FW23|RS5_STAA8 Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]