Structure of PDB 7zsb Chain e

Receptor sequence
>7zsbe (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB7zsb Structures of transcription preinitiation complex engaged with the +1 nucleosome.
Chaine
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna e R40 Y41 R42 P43 G44 V46 R49 R52 R53 R63 K64 L65 P66 R69 R4 Y5 R6 P7 G8 V10 R13 R16 R17 R27 K28 L29 P30 R33
BS02 dna e K37 H39 R40 Y41 R42 P43 R63 R72 R83 F84 Q85 S86 V117 T118 K1 H3 R4 Y5 R6 P7 R27 R36 R47 F48 Q49 S50 V81 T82
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7zsb, PDBe:7zsb, PDBj:7zsb
PDBsum7zsb
PubMed36411341
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]