Structure of PDB 7xtd Chain e

Receptor sequence
>7xtde (length=90) Species: 9606 (Homo sapiens) [Search protein sequence]
TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQE
ASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB7xtd Structural basis of nucleosome disassembly and reassembly by RNAPII elongation complex with FACT.
Chaine
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna e V117 T118 V73 T74
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0001556 oocyte maturation
GO:0001649 osteoblast differentiation
GO:0006334 nucleosome assembly
GO:0006997 nucleus organization
GO:0007283 spermatogenesis
GO:0007286 spermatid development
GO:0007338 single fertilization
GO:0007566 embryo implantation
GO:0008283 cell population proliferation
GO:0008584 male gonad development
GO:0030307 positive regulation of cell growth
GO:0031508 pericentric heterochromatin formation
GO:0031509 subtelomeric heterochromatin formation
GO:0032200 telomere organization
GO:0035264 multicellular organism growth
GO:0042692 muscle cell differentiation
GO:0048477 oogenesis
GO:0090230 regulation of centromere complex assembly
GO:1902340 negative regulation of chromosome condensation
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000781 chromosome, telomeric region
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0000939 inner kinetochore
GO:0001740 Barr body
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0032991 protein-containing complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xtd, PDBe:7xtd, PDBj:7xtd
PDBsum7xtd
PubMed35981082
UniProtP84243|H33_HUMAN Histone H3.3 (Gene Name=H3-3A)

[Back to BioLiP]