Structure of PDB 7w5a Chain e |
>7w5ae (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] |
MVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEE IHSKTKSRKQLGRIMLKGDNITLLQSVSN |
|
PDB | 7w5a Mechanism of exon ligation by human spliceosome. |
Chain | e |
Resolution | 3.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
e |
Y36 Y53 N55 K80 |
Y23 Y40 N42 K67 |
|
|
|
|