Structure of PDB 7ut1 Chain e

Receptor sequence

>7ut1e (length=264) Species: 11757 (Mouse mammary tumor virus)

ALESAQESHALHHQNAAALRFQFHITREQAREIVKLCPNCPDWGHAPQLG
VNPRGLKPRVLWQMDVTHVSEFGKLKYVHVTVDTYSHFTFATARTGEATK
DVLQHLAQSFAYMGIPQKIKTDNAPAYVSRSIQEFLARWKISHVTGIPYN
PQGQAIVERTHQNIKAQLNKLQKAGKYYTPHHLLAHALFVLNHVNMDNQG
HTAAERHWGPISADPKPMVMWKDLLTGSWKGPDVLITAGRGYACVFPQDA
ESPIWVPDRFIRPF

3D structure

• PDB: 7ut1 B-to-A transition in target DNA during retroviral integration.
• Chain: e
• Resolution: 3.8 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.-
  2.7.7.49: RNA-directed DNA polymerase.
  2.7.7.7: DNA-directed DNA polymerase.
  3.1.-.-
  3.1.26.4: ribonuclease H.
  3.4.23.-
  3.6.1.23: dUTP diphosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	e	N15 R31 K35 W43 H45	N15 R31 K35 W43 H45
BS02	dna	e	R20 T26 R27 H45 E97 A98 T99 P125 S129 R130	R20 T26 R27 H45 E97 A98 T99 P125 S129 R130
BS03	dna	e	D122 N123 A124	D122 N123 A124
BS04	dna	e	L49 G50 V51 N52 P53 H87 K120 T145 G146 I147 Q152 A155 R159 N163	L49 G50 V51 N52 P53 H87 K120 T145 G146 I147 Q152 A155 R159 N163
BS05	dna	e	D65 H68 P151 E158 Q162 K165 R240	D65 H68 P151 E158 Q162 K165 R240
BS06	ZN	e	H9 H13 C37 C40	H9 H13 C37 C40

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0008270 zinc ion binding

Biological Process

• GO:0015074 DNA integration

External links

• PDB: RCSB:7ut1, PDBe:7ut1, PDBj:7ut1
• PDBsum: 7ut1
• PubMed: 35947647
• UniProt: P03365|POL_MMTVB Gag-Pro-Pol polyprotein (Gene Name=gag-pro-pol)