Structure of PDB 7unr Chain e

Receptor sequence
>7unre (length=154) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
GYIEKLVQVNRVAKTVKGGRIFAFTALTVVGDGKGRVGFGRGKAREVPAA
IQKAMEAARRNMIQVDLNGTTLQYPTKSAHGASKVYMQPASEGTGIIAGG
AMRAVLEVAGVQNVLAKCYGSTNPVNVVYATFKGLKNMQAPEAVAAKRGK
SVEE
3D structure
PDB7unr Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
Chaine
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e V22 A23 K24 T25 K27 R30 R51 K53 R55 G91 A92 Y96 S101 T104 A108 G109 R113 L125 K127 Y129 S131 T132 V12 A13 K14 T15 K17 R20 R41 K43 R45 G81 A82 Y86 S91 T94 A98 G99 R103 L115 K117 Y119 S121 T122
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7unr, PDBe:7unr, PDBj:7unr
PDBsum7unr
PubMed
UniProtQ9HWF2|RS5_PSEAE Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]