Structure of PDB 7und Chain e

Receptor sequence
>7unde (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence]
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB7und Structural basis of nucleosome retention during transcription elongation.
Chaine
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna e R40 Y41 P43 G44 T45 V46 A47 R63 K64 L65 P66 R69 R83 R2 Y3 P5 G6 T7 V8 A9 R25 K26 L27 P28 R31 R45
BS02 dna e R40 R42 P43 R63 R72 R83 F84 Q85 S86 R116 V117 T118 R2 R4 P5 R25 R34 R45 F46 Q47 S48 R78 V79 T80
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:7und, PDBe:7und, PDBj:7und
PDBsum7und
PubMed35709268
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]