Structure of PDB 7tql Chain e

Receptor sequence
>7tqle (length=51) Species: 9606 (Homo sapiens) [Search protein sequence]
AAAAAARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVKGPNAN
S
3D structure
PDB7tql eIF5B and eIF1A reorient initiator tRNA to allow ribosomal subunit joining.
Chaine
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e A7 K11 V12 R13 T16 K21 Q22 E23 K24 K26 T29 R31 A32 K33 R34 R35 N39 R41 N44 P55 N56 N58 S59 A6 K10 V11 R12 T15 K20 Q21 E22 K23 K25 T28 R30 A31 K32 R33 R34 N38 R40 N43 P47 N48 N50 S51
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7tql, PDBe:7tql, PDBj:7tql
PDBsum7tql
PubMed35732735
UniProtP62861|RS30_HUMAN Ubiquitin-like FUBI-ribosomal protein eS30 fusion protein (Gene Name=FAU)

[Back to BioLiP]