Structure of PDB 7q0p Chain e

Receptor sequence
>7q0pe (length=55) Species: 237561 (Candida albicans SC5314) [Search protein sequence]
AHENVWFSHPRNFGKGSRQCRHCSSHSGLIRKYGLDLCRQCFREKAADIG
FNKYR
3D structure
PDB7q0p E-site drug specificity of the human pathogen Candida albicans ribosome.
Chaine
Resolution2.77 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e A2 H3 V6 W7 F8 S9 H10 R12 F14 K16 G17 R19 H27 L30 I31 R32 K33 Y34 R40 Q41 R44 E45 K54 Y55 R56 A1 H2 V5 W6 F7 S8 H9 R11 F13 K15 G16 R18 H26 L29 I30 R31 K32 Y33 R39 Q40 R43 E44 K53 Y54 R55
BS02 ZN e C21 C39 C42 C20 C38 C41
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030445 yeast-form cell wall
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q0p, PDBe:7q0p, PDBj:7q0p
PDBsum7q0p
PubMed35613268
UniProtA0A1D8PTR4|RS29A_CANAL Small ribosomal subunit protein uS14 (Gene Name=CAALFM_CR08480CA)

[Back to BioLiP]