Structure of PDB 7pfw Chain e

Receptor sequence
>7pfwe (length=97) Species: 9606 (Homo sapiens) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGE
3D structure
PDB7pfw Histone H1 binding to nucleosome arrays depends on linker DNA length and trajectory.
Chaine
Resolution5.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna e R42 T45 R72 R83 F84 Q85 R116 V117 T118 M120 R6 T9 R36 R47 F48 Q49 R80 V81 T82 M84
BS02 dna e H39 R40 Y41 G44 V46 A47 R49 R63 K64 L65 P66 R69 H3 R4 Y5 G8 V10 A11 R13 R27 K28 L29 P30 R33
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pfw, PDBe:7pfw, PDBj:7pfw
PDBsum7pfw
PubMed35581345
UniProtQ71DI3|H32_HUMAN Histone H3.2 (Gene Name=H3C15)

[Back to BioLiP]