Structure of PDB 7pat Chain e

Receptor sequence

>7pate (length=176) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]

KIGNRTITLDPAKVNLNFQKDHIAVKGPLGQIELKLPPNLPLKFELKDNN
LQITRNNELKQSKIFHGTYNALITNAIIGVTQGFEKKLRLVGVGYRANVE
GETLNLQLGYSHPIKEKIPKGLTVKVEKNTEITISGISKELVGQFATEVR
KWRKPEPYKGKGVLYFDEVIVRKAGK

3D structure

PDB

7pat Visualizing translation dynamics at atomic detail inside a bacterial cell.

Chain

Resolution

9.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	K3 I4 R7 K37 K62 Q63 K65 I66 F67 G69 T70 A73 L74 N77 V95 G111 Y112 S113 H114 K141 E142 G145 Q146 T149 R155 P159 Y160 K161 K175 G177 K178	K1 I2 R5 K35 K60 Q61 K63 I64 F65 G67 T68 A71 L72 N75 V93 G109 Y110 S111 H112 K139 E140 G143 Q144 T147 R153 P157 Y158 K159 K173 G175 K176

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pat, PDBe:7pat, PDBj:7pat
PDBsum	7pat
PubMed	36171285
UniProt	Q50303\|RL6_MYCPN Large ribosomal subunit protein uL6 (Gene Name=rplF)

[Back to BioLiP]