Structure of PDB 7oui Chain e

Receptor sequence

>7ouie (length=66) Species: 3702 (Arabidopsis thaliana)

RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLIT
GRFDSLEQLDEFSRSF

3D structure

• PDB: 7oui High-resolution model of Arabidopsis Photosystem II reveals the structural consequences of digitonin-extraction.
• Chain: e
• Resolution: 2.79 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	e	L30 F31 G34 W35 V38	L13 F14 G17 W18 V21
BS02	peptide	e	T67 G68 R69 F70 D71	T50 G51 R52 F53 D54
BS03	HEM	e	Y19 I22 H23 T26 L30	Y2 I5 H6 T9 L13

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0009507 chloroplast
• GO:0009523 photosystem II
• GO:0009535 chloroplast thylakoid membrane
• GO:0009536 plastid
• GO:0009539 photosystem II reaction center
• GO:0009579 thylakoid
• GO:0016020 membrane

External links

• PDB: RCSB:7oui, PDBe:7oui, PDBj:7oui
• PDBsum: 7oui
• PubMed: 34330992
• UniProt: P56779|PSBE_ARATH Cytochrome b559 subunit alpha (Gene Name=psbE)