Structure of PDB 7of1 Chain e

Receptor sequence

>7of1e (length=126) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

ASLPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRRRFRGNIS
QPKIGYGSNKKTKFLSPSGHKTFLVANVKDLETLTMHTKTYAAEIAHNIS
AKNRVVILARAKALGIKVTNPKGRLA

3D structure

PDB

7of1 Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	K11 K12 K15 K16 F17 R19 H20 H21 D23 R24 Y25 H26 R27 V28 N31 W32 R33 K36 G37 D39 R43 R44 R45 F46 R47 G48 I50 P53 K54 I55 G56 Y57 G58 S59 N60 K61 K64 F65 P68 K80 E95 I96 A97 H98 N99 S101 N104 R105 K118 N121 G124 R125	K10 K11 K14 K15 F16 R18 H19 H20 D22 R23 Y24 H25 R26 V27 N30 W31 R32 K35 G36 D38 R42 R43 R44 F45 R46 G47 I49 P52 K53 I54 G55 Y56 G57 S58 N59 K60 K63 F64 P67 K79 E94 I95 A96 H97 N98 S100 N103 R104 K117 N120 G123 R124

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7of1, PDBe:7of1, PDBj:7of1
PDBsum	7of1
PubMed	34813592
UniProt	P38061\|RL32_YEAST Large ribosomal subunit protein eL32 (Gene Name=RPL32)

[Back to BioLiP]