Structure of PDB 7mt3 Chain e

Receptor sequence
>7mt3e (length=169) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
NYLERVVAINRVSKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAA
IAKGVEEARKSFFRVPLIGGTITHPVQGEAAAGVVLLRPASPGTGVIAGG
AARAVLECAGVHDILAKSLGSDNAINVVHATVAALKLLQRPEEVAARRGL
PIEDVAPAGMLKARRKSEA
3D structure
PDB7mt3 Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
Chaine
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e V52 S53 K54 V55 V56 K57 G58 R60 Y81 K83 K93 A121 L126 A130 S131 I137 A138 G139 R143 A156 K157 S158 L159 S161 N163 N166 V12 S13 K14 V15 V16 K17 G18 R20 Y41 K43 K53 A81 L86 A90 S91 I97 A98 G99 R103 A116 K117 S118 L119 S121 N123 N126
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7mt3, PDBe:7mt3, PDBj:7mt3
PDBsum7mt3
PubMed35064151
UniProtP9WH33|RS5_MYCTU Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]