Structure of PDB 7jro Chain e |
>7jroe (length=94) Species: 3916 (Vigna radiata var. radiata) [Search protein sequence] |
PIATGHEREEIQASLEGRDILEINHPEGPFGTKEAPAIVKSYFDRRIVGC PGGEGEDEHDVVWFWLENGKPHECPVCSQYFELKVVGPGGDPYG |
|
PDB | 7jro Atomic structures of respiratory complex III 2 , complex IV, and supercomplex III 2 -IV from vascular plants. |
Chain | e |
Resolution | 3.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
e |
C101 H110 C125 C128 |
C50 H59 C74 C77 |
|
|
|
|