Structure of PDB 7dxh Chain e

Receptor sequence
>7dxhe (length=63) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
VIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRF
EAKQQVETFLEQL
3D structure
PDB7dxh Structural insights into cyanobacterial photosystem II intermediates associated with Psb28 and Tsl0063.
Chaine
Resolution3.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide e L30 A33 G34 W35 V38 L10 A13 G14 W15 V18
BS02 HEM e H23 T26 H3 T6
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dxh, PDBe:7dxh, PDBj:7dxh
PDBsum7dxh
PubMed34226692
UniProtP12238|PSBE_THEVL Cytochrome b559 subunit alpha (Gene Name=psbE)

[Back to BioLiP]