Structure of PDB 7czl Chain e

Receptor sequence
>7czle (length=65) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
WVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDR
FEAKQQVETFLEQLK
3D structure
PDB7czl Structural insights into a dimeric Psb27-photosystem II complex from a cyanobacterium Thermosynechococcus vulcanus .
Chaine
Resolution3.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide e F5031 G5034 W5035 F5037 V5038 F12 G15 W16 F18 V19
BS02 HEM e H5023 T5026 H4 T7
Gene Ontology
Molecular Function
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009523 photosystem II
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7czl, PDBe:7czl, PDBj:7czl
PDBsum7czl
PubMed33495333
UniProtP12238|PSBE_THEVL Cytochrome b559 subunit alpha (Gene Name=psbE)

[Back to BioLiP]