Structure of PDB 7bl5 Chain e

Receptor sequence
>7bl5e (length=131) Species: 511145 (Escherichia coli str. K-12 substr. MG1655) [Search protein sequence]
MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGV
YMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFA
KANAKFEVKAAAFEGELIPASQIDRLATLPT
3D structure
PDB7bl5 Snapshots of native pre-50S ribosomes reveal a biogenesis factor network and evolutionary specialization.
Chaine
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e M1 K8 I11 S30 R31 G32 T34 K37 L41 V50 M52 R53 V54 V55 R56 T58 L59 R61 R62 E65 L81 M1 K8 I11 S30 R31 G32 T34 K37 L41 V50 M52 R53 V54 V55 R56 T58 L59 R61 R62 E65 L81
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0043022 ribosome binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7bl5, PDBe:7bl5, PDBj:7bl5
PDBsum7bl5
PubMed33639093
UniProtP0A7J3|RL10_ECOLI Large ribosomal subunit protein uL10 (Gene Name=rplJ)

[Back to BioLiP]