Structure of PDB 7ae4 Chain e |
>7ae4e (length=67) Species: 29345 (Sedimentibacter hydroxybenzoicus) [Search protein sequence] |
MKCHRCGSDNVRKMVDSPVGDAWEVYVCEKCCYSWRSTENPVVMEKFKLD DNKIANMGVIPPIPPLK |
|
PDB | 7ae4 Domain mobility and allosteric activation of UbiD decarboxylases |
Chain | e |
Resolution | 3.31 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
e |
C603 C606 C628 C631 |
C3 C6 C28 C31 |
|
|
|
|