Structure of PDB 6zxe Chain e

Receptor sequence
>6zxee (length=47) Species: 9606 (Homo sapiens) [Search protein sequence]
SLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVGPNANS
3D structure
PDB6zxe Structural basis for the final steps of human 40S ribosome maturation.
Chaine
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e R8 A9 G10 K11 V12 Q15 T16 V19 K21 K24 K25 K26 T29 R31 K33 R34 R35 N39 R41 N44 G54 P55 N56 N58 R4 A5 G6 K7 V8 Q11 T12 V15 K17 K20 K21 K22 T25 R27 K29 R30 R31 N35 R37 N40 G42 P43 N44 N46
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zxe, PDBe:6zxe, PDBj:6zxe
PDBsum6zxe
PubMed33208940
UniProtP62861|RS30_HUMAN Ubiquitin-like FUBI-ribosomal protein eS30 fusion protein (Gene Name=FAU)

[Back to BioLiP]