Structure of PDB 6ysu Chain e

Receptor sequence

>6ysue (length=157) Species: 562 (Escherichia coli)

ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGG
AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGK
SVEEILG

3D structure

• PDB: 6ysu Mechanism of ribosome rescue by alternative ribosome-rescue factor B.
• Chain: e
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	N18 V20 S21 K22 T23 V24 K25 G26 R28 Y49 K51 R53 R68 F94 Q96 A98 S99 I105 A106 G107 R111 L123 A124 K125 A126 Y127 S129 T130 N131 N134 R137	N10 V12 S13 K14 T15 V16 K17 G18 R20 Y41 K43 R45 R60 F86 Q88 A90 S91 I97 A98 G99 R103 L115 A116 K117 A118 Y119 S121 T122 N123 N126 R129

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ysu, PDBe:6ysu, PDBj:6ysu
• PDBsum: 6ysu
• PubMed: 32796827
• UniProt: C3SR27