Structure of PDB 6ysr Chain e

Receptor sequence

>6ysre (length=157) Species: 562 (Escherichia coli) [Search protein sequence]

ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGG
AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGK
SVEEILG

3D structure

PDB

6ysr Mechanism of ribosome rescue by alternative ribosome-rescue factor B.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	V20 S21 K22 T23 V24 K25 G26 R28 Y49 K51 K61 R68 T89 F94 S99 A106 G107 G108 R111 L123 A124 K125 A126 Y127 S129 T130 N131 I133 N134 R137	V12 S13 K14 T15 V16 K17 G18 R20 Y41 K43 K53 R60 T81 F86 S91 A98 G99 G100 R103 L115 A116 K117 A118 Y119 S121 T122 N123 I125 N126 R129

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ysr, PDBe:6ysr, PDBj:6ysr
PDBsum	6ysr
PubMed	32796827
UniProt	C3SR27

[Back to BioLiP]