Structure of PDB 6ypu Chain e

Receptor sequence

>6ypue (length=207) Species: 575584 (Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841) [Search protein sequence]

ARYIGPKCKLSRREGTDLQLKSGVKPFDVKTKKANKAPGQHGQARGGKQS
EYSLQLREKQKVRRIYGVLERQFSNYYKEAARVKGATGENLLKLLESRLD
NVVYRMGFGSTRAEARQLVSHRSITLNGRRVNIASIQVKAGDVIAVHEGA
KQQLRIKNAIELAAQRGIPAWIEVDHSKLEGTFKAAPDRSDLPAEINESL
IVELYSK

3D structure

PDB

6ypu Structure of the 70S Ribosome from the Human Pathogen Acinetobacter baumannii in Complex with Clinically Relevant Antibiotics.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	A2 R3 P7 K8 C9 K10 R13 R14 K22 S23 K31 T32 K33 K34 K37 G40 Q41 H42 Y53 R58 Q61 E71 R72 R83 K85 T112 A114 E115 Q118 S121 H122 R123 R130 V132 N133 S136 Q154 R156 E204 K208	A1 R2 P6 K7 C8 K9 R12 R13 K21 S22 K30 T31 K32 K33 K36 G39 Q40 H41 Y52 R57 Q60 E70 R71 R82 K84 T111 A113 E114 Q117 S120 H121 R122 R129 V131 N132 S135 Q153 R155 E203 K207

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ypu, PDBe:6ypu, PDBj:6ypu
PDBsum	6ypu
PubMed	32857965
UniProt	D0CD21

[Back to BioLiP]