Structure of PDB 6y7c Chain e

Receptor sequence
>6y7ce (length=60) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AKVHGSLARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVN
GKRRMNPGPS
3D structure
PDB6y7c Good Vibrations: Structural Remodeling of Maturing Yeast Pre-40S Ribosomal Particles Followed by Cryo-Electron Microscopy.
Chaine
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e G12 K13 K15 S16 Q17 T18 K23 E25 K26 P27 K28 P30 K31 G32 Y35 R42 R43 R54 R55 M56 N57 P58 G59 P60 S61 G11 K12 K14 S15 Q16 T17 K22 E24 K25 P26 K27 P29 K30 G31 Y34 R41 R42 R53 R54 M55 N56 P57 G58 P59 S60
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0010494 cytoplasmic stress granule
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6y7c, PDBe:6y7c, PDBj:6y7c
PDBsum6y7c
PubMed32138239
UniProtP0CX33|RS30A_YEAST Small ribosomal subunit protein eS30A (Gene Name=RPS30A)

[Back to BioLiP]