Structure of PDB 6rbe Chain e

Receptor sequence
>6rbee (length=60) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AKVHGSLARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVN
GKRRMNPGPS
3D structure
PDB6rbe Conformational proofreading of distant 40S ribosomal subunit maturation events by a long-range communication mechanism.
Chaine
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e K3 V4 H5 G6 R10 G12 K13 V14 K15 Q17 V21 K23 T24 E25 K26 K28 P30 K31 R33 A34 R37 R42 R43 M56 N57 P60 K2 V3 H4 G5 R9 G11 K12 V13 K14 Q16 V20 K22 T23 E24 K25 K27 P29 K30 R32 A33 R36 R41 R42 M55 N56 P59
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0010494 cytoplasmic stress granule
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6rbe, PDBe:6rbe, PDBj:6rbe
PDBsum6rbe
PubMed31227701
UniProtP0CX33|RS30A_YEAST Small ribosomal subunit protein eS30A (Gene Name=RPS30A)

[Back to BioLiP]