Structure of PDB 6q95 Chain e

Receptor sequence

>6q95e (length=63) Species: 300852 (Thermus thermophilus HB8)

PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLA
KPEAERIKLLLPY

3D structure

• PDB: 6q95 How a circularized tmRNA moves through the ribosome.
• Chain: e
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	P2 K3 M4 K5 T6 H7 K8 K12 R13 T17 A18 S19 K21 K26 T27 G28 K29 R30 H31 L32 N33 W34 Q35 I41 R42 Q43 R46 K47 F48 K52 E54 L61 L62 Y64	P1 K2 M3 K4 T5 H6 K7 K11 R12 T16 A17 S18 K20 K25 T26 G27 K28 R29 H30 L31 N32 W33 Q34 I40 R41 Q42 R45 K46 F47 K51 E53 L60 L61 Y63

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6q95, PDBe:6q95, PDBj:6q95
• PDBsum: 6q95
• PubMed: 30765567
• UniProt: Q5SKU1|RL35_THET8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)