Structure of PDB 6kac Chain e

Receptor sequence

>6kace (length=76) Species: 3055 (Chlamydomonas reinhardtii)

ERPFSDILTSIRYWVIHSITVPALFIAGWLFVSTGLAYDVFGTPRPNEYF
TEDRQEAPLITDRFNALEQVKKLSGN

3D structure

• PDB: 6kac Structural insight into light harvesting for photosystem II in green algae.
• Chain: e
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	e	T67 D68 N71 K78	T61 D62 N65 K72
BS02	HEM	e	I13 R18 Y19 H23	I7 R12 Y13 H17

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0009507 chloroplast
• GO:0009523 photosystem II
• GO:0009535 chloroplast thylakoid membrane
• GO:0009536 plastid
• GO:0009539 photosystem II reaction center
• GO:0009579 thylakoid
• GO:0016020 membrane

External links

• PDB: RCSB:6kac, PDBe:6kac, PDBj:6kac
• PDBsum: 6kac
• PubMed: 31768031
• UniProt: P48268|PSBE_CHLRE Cytochrome b559 subunit alpha (Gene Name=psbE)