Structure of PDB 6j6n Chain e

Receptor sequence

>6j6ne (length=101) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

RPKHELSRAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIAR
VKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKT
P

3D structure

PDB

6j6n Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.

Chain

Resolution

3.86 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	R49 R63 H64 N66 K80 G81 R97 G98 D99	R42 R56 H57 N59 K73 G74 R90 G91 D92

Gene Ontology

	Biological Process
GO:0000245	spliceosomal complex assembly
GO:0000387	spliceosomal snRNP assembly
GO:0000395	mRNA 5'-splice site recognition
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008150	biological_process
GO:0008380	RNA splicing
GO:0036261	7-methylguanosine cap hypermethylation
GO:1903241	U2-type prespliceosome assembly

	Cellular Component
GO:0000243	commitment complex
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0005682	U5 snRNP
GO:0005685	U1 snRNP
GO:0005686	U2 snRNP
GO:0005687	U4 snRNP
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0030532	small nuclear ribonucleoprotein complex
GO:0032991	protein-containing complex
GO:0034715	pICln-Sm protein complex
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071001	U4/U6 snRNP
GO:0071004	U2-type prespliceosome
GO:0071011	precatalytic spliceosome
GO:0071013	catalytic step 2 spliceosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6j6n, PDBe:6j6n, PDBj:6j6n
PDBsum	6j6n
PubMed	30879786
UniProt	Q06217\|SMD2_YEAST Small nuclear ribonucleoprotein Sm D2 (Gene Name=SMD2)