Structure of PDB 6j40 Chain e

Receptor sequence

>6j40e (length=75)

RPFSDIITSVRYWIIHSITIPSLFVSGWLFISTGLAYDVFGTPRPNEYFT
QDRQQVPLVNDRFSAKQELEDLTKG

3D structure

• PDB: 6j40 Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.
• Chain: e
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	e	L31 F32 S34 G35 W36 I39 P53	L23 F24 S26 G27 W28 I31 P45
BS02	HEM	e	R19 Y20 I23 H24 I28	R11 Y12 I15 H16 I20

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 01:23:58 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6j40', asym_id = 'e', title = 'Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6j40', asym_id='e', title='Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009523,0009539,0009767,0015979,0016020,0019684,0020037,0046872', uniprot = '', pdbid = '6j40', asym_id = 'e'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009523,0009539,0009767,0015979,0016020,0019684,0020037,0046872', uniprot='', pdbid='6j40', asym_id='e')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>