Structure of PDB 6htq Chain e

Receptor sequence
>6htqe (length=164) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
RIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGK
AQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNILLKPASEG
TGVIAGGPVRAVLELAGVADILSKSLGSNTPINMIRATLQGLSELKRAED
VAKLRGKSVEELLG
3D structure
PDB6htq Structural Basis for Regulation of the Opposing (p)ppGpp Synthetase and Hydrolase within the Stringent Response Orchestrator Rel.
Chaine
Resolution4.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e N19 V21 A22 K23 V24 V25 K26 G27 R29 R32 K52 Q54 K62 K69 G90 K97 S100 I106 A107 S125 K126 S127 L128 S130 N131 T132 N135 R138 N17 V19 A20 K21 V22 V23 K24 G25 R27 R30 K50 Q52 K60 K67 G88 K95 S98 I104 A105 S123 K124 S125 L126 S128 N129 T130 N133 R136
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0046677 response to antibiotic
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6htq, PDBe:6htq, PDBj:6htq
PDBsum6htq
PubMed32937119
UniProtP21467|RS5_BACSU Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]