Structure of PDB 6ha1 Chain e

Receptor sequence

>6ha1e (length=164) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]

RIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGK
AQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNILLKPASEG
TGVIAGGPVRAVLELAGVADILSKSLGSNTPINMIRATLQGLSELKRAED
VAKLRGKSVEELLG

3D structure

PDB

6ha1 Structural basis for antibiotic resistance mediated by theBacillus subtilisABCF ATPase VmlR.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	N19 V21 A22 K23 V24 V25 K26 G27 R29 R30 R32 K52 K62 K69 A91 L95 K97 A99 S100 T103 A107 L124 S125 K126 S127 L128 S130 N131 T132 N135 R138	N17 V19 A20 K21 V22 V23 K24 G25 R27 R28 R30 K50 K60 K67 A89 L93 K95 A97 S98 T101 A105 L122 S123 K124 S125 L126 S128 N129 T130 N133 R136

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0046677	response to antibiotic

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ha1, PDBe:6ha1, PDBj:6ha1
PDBsum	6ha1
PubMed	30126986
UniProt	P21467\|RS5_BACSU Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]