Structure of PDB 6fyy Chain e

Receptor sequence
>6fyye (length=60) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]
GKVHGSLARAGKVKSQTPKVEKQEKPKQPKGRAYKRLLYTRRFVNVTLTN
GKRKMNPSPS
3D structure
PDB6fyy Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
Chaine
Resolution3.02 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e A9 A11 G12 K13 V14 K15 Q17 T18 V21 K23 Q24 K26 K28 P30 K31 G32 R33 A34 K36 R37 L39 R42 R43 V45 N46 K55 M56 N57 S59 A8 A10 G11 K12 V13 K14 Q16 T17 V20 K22 Q23 K25 K27 P29 K30 G31 R32 A33 K35 R36 L38 R41 R42 V44 N45 K54 M55 N56 S58
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fyy, PDBe:6fyy, PDBj:6fyy
PDBsum6fyy
PubMed30475211
UniProtQ6CUH5

[Back to BioLiP]