Structure of PDB 6em1 Chain e

Receptor sequence

>6em1e (length=125) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

LPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRRRFRGNISQP
KIGYGSNKKTKFLSPSGHKTFLVANVKDLETLTMHTKTYAAEIAHNISAK
NRVVILARAKALGIKVTNPKGRLAL

3D structure

PDB

6em1 Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.

Chain

Resolution

3.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	H6 K8 K11 K12 K15 K16 F17 R19 H21 R24 H26 R27 V28 W32 R33 K34 K36 R43 R44 R45 F46 R47 G48 P53 K54 I55 G56 Y57 G58 S59 K61 K64 F65 K80 A97 H98 N99 I100 S101 K103 N104 R105 K113 N121 R125 L128	H3 K5 K8 K9 K12 K13 F14 R16 H18 R21 H23 R24 V25 W29 R30 K31 K33 R40 R41 R42 F43 R44 G45 P50 K51 I52 G53 Y54 G55 S56 K58 K61 F62 K77 A94 H95 N96 I97 S98 K100 N101 R102 K110 N118 R122 L125

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6em1, PDBe:6em1, PDBj:6em1
PDBsum	6em1
PubMed	29245012
UniProt	P38061\|RL32_YEAST Large ribosomal subunit protein eL32 (Gene Name=RPL32)