Structure of PDB 5xy3 Chain e

Receptor sequence

>5xy3e (length=123) Species: 5722 (Trichomonas vaginalis) [Search protein sequence]

AEHKPIIHKKTNRFHRPQSDLWNRVPSAWRHPRGIDSRFRRKYRGTPLHP
SAGFGSDKETRFMLPNGFIPVIVRSLKDLDMLLTKNTTHGAMISAQVGAK
LQQEIIKKAQELNIEILNQARKH

3D structure

PDB

5xy3 Cryo-EM structures of the 80S ribosomes from human parasites Trichomonas vaginalis and Toxoplasma gondii

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	H12 K13 R17 F18 H19 R20 Q22 D24 W26 N27 R28 A32 W33 R34 H35 G38 I39 D40 S41 R42 F43 K46 Y47 R48 G49 P54 S55 A56 G57 F58 G59 S60 D61 K62 R65 F66 R78 S79 S98 A99 Q100 A103 K104 L105 R125 K126	H8 K9 R13 F14 H15 R16 Q18 D20 W22 N23 R24 A28 W29 R30 H31 G34 I35 D36 S37 R38 F39 K42 Y43 R44 G45 P50 S51 A52 G53 F54 G55 S56 D57 K58 R61 F62 R74 S75 S94 A95 Q96 A99 K100 L101 R121 K122

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links