Structure of PDB 5xtd Chain e |
>5xtde (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] |
PWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGS TFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLP |
|
PDB | 5xtd Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2. |
Chain | e |
Resolution | 3.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PLX |
e |
A107 Y108 |
A54 Y55 |
|
|
|