Structure of PDB 5on6 Chain e

Receptor sequence
>5on6e (length=53) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
ENVWFSHPRRYGKGSRQCRVCSSHTGLIRKYGLNICRQCFREKANDIGFN
KFR
3D structure
PDB5on6 The Amaryllidaceae Alkaloid Haemanthamine Binds the Eukaryotic Ribosome to Repress Cancer Cell Growth.
Chaine
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e W7 F8 S9 H10 R12 R13 Y14 G15 K16 G17 R19 C24 L30 I31 R32 K33 Y34 R40 Q41 R44 E45 K54 F55 R56 W4 F5 S6 H7 R9 R10 Y11 G12 K13 G14 R16 C21 L27 I28 R29 K30 Y31 R37 Q38 R41 E42 K51 F52 R53
BS02 OHX e S25 H27 S22 H24
BS03 ZN e C21 C24 C39 C42 C18 C21 C36 C39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5on6, PDBe:5on6, PDBj:5on6
PDBsum5on6
PubMed29429877
UniProtP41057|RS29A_YEAST Small ribosomal subunit protein uS14A (Gene Name=RPS29A)

[Back to BioLiP]