Structure of PDB 5njt Chain e

Receptor sequence

>5njte (length=146) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGGVRPGF
EGGQMPLFQRLPKRGFTNINRKEYAVVNLDKLNGFAEGTEVTPELLLETG
VISKLNAGVKILGNGKLEKKLTVKANKFSASAKEAVEAAGGTAEVI

3D structure

• PDB: 5njt Structure of the Bacillus subtilis hibernating 100S ribosome reveals the basis for 70S dimerization.
• Chain: e
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e	L3 H4 L6 K7 P8 E10 G11 S12 K14 R16 R18 G20 R21 G22 I23 G24 N27 G28 K29 T30 A31 G32 K33 H35 K36 G37 Q38 N39 A40 R41 S42 G43 R47 F50 G52 G53 Q54 F58 Q59 R60 K63 R64 G65 F66 T67 N68 I69 R71 V76 K81 S103 K104 K110 L112 G113 K127 A130 S131	L3 H4 L6 K7 P8 E10 G11 S12 K14 R16 R18 G20 R21 G22 I23 G24 N27 G28 K29 T30 A31 G32 K33 H35 K36 G37 Q38 N39 A40 R41 S42 G43 R47 F50 G52 G53 Q54 F58 Q59 R60 K63 R64 G65 F66 T67 N68 I69 R71 V76 K81 S103 K104 K110 L112 G113 K127 A130 S131

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5njt, PDBe:5njt, PDBj:5njt
• PDBsum: 5njt
• PubMed: 28468753
• UniProt: P19946|RL15_BACSU Large ribosomal subunit protein uL15 (Gene Name=rplO)